Recombinant Human CNOT6 Protein, GST-tagged

• Cat.No.: CNOT6-1584H
• Product Overview: Human CNOT6 full-length ORF ( AAH27476.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the catalytic component of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3'-5' RNase activity and prefers polyadenylated substrates. The CCR4-NOT complex plays a role in many cellular processes, including miRNA-mediated repression, mRNA degradation, and transcriptional regulation. [provided by RefSeq, Dec 2014]
• Molecular Mass: 36.7 kDa
• AA Sequence: MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNOT6 CCR4-NOT transcription complex, subunit 6 [ Homo sapiens ]
• Official Symbol: CNOT6
• Synonyms: CNOT6; CCR4-NOT transcription complex, subunit 6; CCR4-NOT transcription complex subunit 6; CCR4; KIAA1194; cytoplasmic deadenylase; carbon catabolite repression 4 protein; carbon catabolite repressor protein 4 homolog
• Gene ID: 57472
• mRNA Refseq: NM_015455
• Protein Refseq: NP_056270
• MIM: 608951
• UniProt ID: Q9ULM6