Recombinant Human CNN3

• Cat.No.: CNN3-26293TH
• Product Overview: Recombinant fragment of Human Acidic Calponin with N terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Description: This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in both non-smooth muscle tissues as well as smooth muscle tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
• Sequence Similarities: Belongs to the calponin family.Contains 3 calponin-like repeats.Contains 1 CH (calponin-homology) domain.
• Tag: Non

Gene Information

• Gene Name: CNN3 calponin 3, acidic [ Homo sapiens ]
• Official Symbol: CNN3
• Synonyms: CNN3; calponin 3, acidic; calponin-3
• Gene ID: 1266
• mRNA Refseq: NM_001839
• Protein Refseq: NP_001830
• MIM: 602374
• Uniprot ID: Q15417
• Chromosome Location: 1p22-p21
• Function: actin binding; actin binding; calmodulin binding; tropomyosin binding; troponin C binding