Recombinant Human CNN2 Protein, GST-tagged

• Cat.No.: CNN2-1567H
• Product Overview: Human CNN2 full-length ORF (1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. The encoded protein could play a role in smooth muscle contraction and cell adhesion. Several pseudogenes of this gene have been identified, and are present on chromosomes 1, 2, 3, 6, 9, 11, 13, 15, 16, 21 and 22. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 60.1 kDa
• AA Sequence: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNN2 calponin 2 [ Homo sapiens ]
• Official Symbol: CNN2
• Synonyms: CNN2; calponin 2; calponin-2; neutral calponin; calponin H2, smooth muscle
• Gene ID: 1265
• mRNA Refseq: NM_004368
• Protein Refseq: NP_004359
• MIM: 602373
• UniProt ID: Q99439