Recombinant Human CNDP1 Protein, GST-tagged
Cat.No. : | CNDP1-1552H |
Product Overview : | Human CNDP1 full-length ORF ( NP_116038.4, 1 a.a. - 507 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 83.1 kDa |
AA Sequence : | MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNDP1 carnosine dipeptidase 1 (metallopeptidase M20 family) [ Homo sapiens ] |
Official Symbol | CNDP1 |
Synonyms | CNDP1; carnosine dipeptidase 1 (metallopeptidase M20 family); beta-Ala-His dipeptidase; carnosinase 1; CN1; CPGL2; glutamate carboxypeptidase like protein 2; HsT2308; MGC10825; serum carnosinase; CNDP dipeptidase 1; glutamate carboxypeptidase-like protein 2; MGC102737; MGC142072; |
Gene ID | 84735 |
mRNA Refseq | NM_032649 |
Protein Refseq | NP_116038 |
MIM | 609064 |
UniProt ID | Q96KN2 |
◆ Recombinant Proteins | ||
Cndp1-2214M | Recombinant Mouse Cndp1 Protein, Myc/DDK-tagged | +Inquiry |
CNDP1-382H | Recombinant Human CNDP1 Protein, His-tagged | +Inquiry |
CNDP1-2241H | Recombinant Human CNDP1 Protein (Pro28-His507), C-His tagged | +Inquiry |
CNDP1-272H | Active Recombinant Human CNDP1, His-tagged | +Inquiry |
CNDP1-11373H | Recombinant Human CNDP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNDP1-3037HCL | Recombinant Human CNDP1 cell lysate | +Inquiry |
CNDP1-1580MCL | Recombinant Mouse CNDP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNDP1 Products
Required fields are marked with *
My Review for All CNDP1 Products
Required fields are marked with *
0
Inquiry Basket