Recombinant Human CNDP1 Protein

• Cat.No.: CNDP1-788H
• Product Overview: Recombinant human CNDP1 protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 507
• Description: This gene encodes a member of the M20 metalloprotease family. The encoded protein is specifically expressed in the brain, is a homodimeric dipeptidase which was identified as human carnosinase. This gene contains trinucleotide (CTG) repeat length polymorphism in the coding region.
• Form: Lyophilized
• Molecular Mass: 54.7 kDa
• AA Sequence: MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CNDP1 carnosine dipeptidase 1 (metallopeptidase M20 family) [ Homo sapiens (human) ]
• Official Symbol: CNDP1
• Synonyms: CNDP1; carnosine dipeptidase 1 (metallopeptidase M20 family); beta-Ala-His dipeptidase; carnosinase 1; CN1; CPGL2; glutamate carboxypeptidase like protein 2; HsT2308; MGC10825; serum carnosinase; CNDP dipeptidase 1; glutamate carboxypeptidase-like protein 2; MGC102737; MGC142072
• Gene ID: 84735
• mRNA Refseq: NM_032649
• Protein Refseq: NP_116038
• MIM: 609064
• UniProt ID: Q96KN2