Recombinant Human CMTM7 Protein, GST-tagged

• Cat.No.: CMTM7-1396H
• Product Overview: Human CKLFSF7 full-length ORF ( AAH10116, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]
• Molecular Mass: 44.99 kDa
• AA Sequence: MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMTM7 CKLF-like MARVEL transmembrane domain containing 7 [ Homo sapiens ]
• Official Symbol: CMTM7
• Synonyms: CMTM7; CKLF-like MARVEL transmembrane domain containing 7; chemokine like factor super family 7 , chemokine like factor superfamily 7 , CKLFSF7; CKLF-like MARVEL transmembrane domain-containing protein 7; FLJ30992; chemokine-like factor superfamily 7; chemokine-like factor super family 7; chemokine-like factor superfamily member 7; chemokine-like factor super family member 7 variant 2; CKLFSF7
• Gene ID: 112616
• mRNA Refseq: NM_138410
• Protein Refseq: NP_612419
• MIM: 607890
• UniProt ID: Q96FZ5