Recombinant Human CMSS1 Protein, GST-Tagged

Cat.No. : CMSS1-0022H
Product Overview : Human C3orf26 full-length ORF (NP_115735.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : CMSS1 (Cms1 Ribosomal Small Subunit Homolog (Yeast)) is a Protein Coding gene. Diseases associated with CMSS1 include Refractive Error. GO annotations related to this gene include nucleic acid binding and poly(A) RNA binding.
Molecular Mass : 58.2 kDa
AA Sequence : MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKTRKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKGICPKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGVGTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMSS1 cms1 ribosomal small subunit homolog (yeast) [ Homo sapiens (human) ]
Official Symbol CMSS1
Synonyms CMSS1; cms1 ribosomal small subunit homolog (yeast);
Gene ID 84319
mRNA Refseq NM_032359
Protein Refseq NP_115735
UniProt ID Q9BQ75

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CMSS1 Products

Required fields are marked with *

My Review for All CMSS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon