Recombinant Human CMKLR1 protein, His-GST&Myc-tagged

• Cat.No.: CMKLR1-4633H
• Product Overview: Recombinant Human CMKLR1 protein(Q99788)(321-373aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST&C-Myc
• Protein length: 321-373aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 41.3 kDa
• AASequence: QDFKKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CMKLR1 chemokine-like receptor 1 [ Homo sapiens ]
• Official Symbol: CMKLR1
• Synonyms: CMKLR1; chemokine-like receptor 1; chemokine receptor-like 1; G-protein coupled receptor DEZ; G-protein coupled receptor ChemR23; orphan G-protein coupled receptor, Dez; DEZ; ChemR23; CHEMERINR; MGC126105; MGC126106
• Gene ID: 1240
• mRNA Refseq: NM_001142343
• Protein Refseq: NP_001135815
• MIM: 602351
• UniProt ID: Q99788