Recombinant Human CMC1 Protein, GST-tagged

• Cat.No.: CMC1-1535H
• Product Overview: Human CMC1 full-length ORF (AAH52644.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CMC1 (C-X9-C Motif Containing 1) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 38.06 kDa
• AA Sequence: MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMC1 COX assembly mitochondrial protein 1 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CMC1
• Synonyms: C3orf68
• Gene ID: 152100
• mRNA Refseq: NM_182523.1
• Protein Refseq: NP_872329.1
• MIM: 616990
• UniProt ID: Q7Z7K0