Recombinant Human CMAS protein, GST-tagged

• Cat.No.: CMAS-301273H
• Product Overview: Recombinant Human CMAS (1-263 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Arg263
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVGNIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CMAS cytidine monophosphate N-acetylneuraminic acid synthetase [ Homo sapiens ]
• Official Symbol: CMAS
• Synonyms: CMAS; cytidine monophosphate N-acetylneuraminic acid synthetase; N-acylneuraminate cytidylyltransferase; CMP Neu5Ac synthetase; CMP-NeuNAc synthase; CMP-Neu5Ac synthetase; CMP-NeuNAc synthetase; CMP-N-acetylneuraminic acid synthase; CMP-N-acetylneuraminic acid synthetase; cytidine 5-monophosphate N-acetylneuraminic acid synthetase
• Gene ID: 55907
• mRNA Refseq: NM_018686
• Protein Refseq: NP_061156
• MIM: 603316
• UniProt ID: Q8NFW8