Recombinant Human CLU protein, His-tagged

• Cat.No.: CLU-2707H
• Product Overview: Recombinant Human CLU protein(P10909)(23-224aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-224aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.8 kDa
• AA Sequence: DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CLU clusterin [ Homo sapiens ]
• Official Symbol: CLU
• Synonyms: CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903
• Gene ID: 1191
• mRNA Refseq: NM_001831
• Protein Refseq: NP_001822
• MIM: 185430
• UniProt ID: P10909