Recombinant Human CLU protein, His-tagged

Cat.No. : CLU-2707H
Product Overview : Recombinant Human CLU protein(P10909)(23-224aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-224aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 27.8 kDa
AA Sequence : DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CLU clusterin [ Homo sapiens ]
Official Symbol CLU
Synonyms CLU; clusterin; APOJ, CLI, clusterin (complement lysis inhibitor, SP 40,40, sulfated glycoprotein 2, testosterone repressed prostate message 2, apolipoprotein J); apolipoprotein J; complement lysis inhibitor; KUB1; SGP 2; SP 40; sulfated glycoprotein 2; testosterone repressed prostate message 2; TRPM 2; ku70-binding protein 1; aging-associated protein 4; complement cytolysis inhibitor; complement-associated protein SP-40,40; testosterone-repressed prostate message 2; CLI; AAG4; APOJ; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; MGC24903;
Gene ID 1191
mRNA Refseq NM_001831
Protein Refseq NP_001822
MIM 185430
UniProt ID P10909

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLU Products

Required fields are marked with *

My Review for All CLU Products

Required fields are marked with *

0

Inquiry Basket

cartIcon