Recombinant Human CLRN1 protein, His-tagged

• Cat.No.: CLRN1-2669H
• Product Overview: Recombinant Human CLRN1 protein(156-232 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 156-232 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CLRN1 clarin 1 [ Homo sapiens ]
• Official Symbol: CLRN1
• Synonyms: CLRN1; clarin 1; USH3, USH3A, Usher syndrome 3A; clarin-1; Usher syndrome type-3 protein; RP61; USH3; USH3A
• Gene ID: 7401
• mRNA Refseq: NM_001195794
• Protein Refseq: NP_001182723
• MIM: 606397
• UniProt ID: P58418