Recombinant Human CLIP2, His-tagged
Cat.No. : | CLIP2-27020TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 746-1011 of Human CYLN2 with N terminal His tag, Predicted MWt 31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 746-1011 a.a. |
Description : | The protein encoded by this gene belongs to the family of cytoplasmic linker proteins, which have been proposed to mediate the interaction between specific membranous organelles and microtubules. This protein was found to associate with both microtubules and an organelle called the dendritic lamellar body. This gene is hemizygously deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 56 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIR TKETVEGLQDKLNKRDKEVTALTSQTEMLRAQVSALES KCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLV LISQELLRKERSLNELRVLLLEANRHSPGPERDLSREV HKAEWRIKEQKLKDDIRGLREKLTGLDKEKSLSDQRRYSLIDPSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLME AMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH |
Sequence Similarities : | Contains 2 CAP-Gly domains. |
Gene Name | CLIP2 CAP-GLY domain containing linker protein 2 [ Homo sapiens ] |
Official Symbol | CLIP2 |
Synonyms | CLIP2; CAP-GLY domain containing linker protein 2; CYLN2, cytoplasmic linker 2 , WBSCR3, WBSCR4, Williams Beuren syndrome chromosome region 3; CAP-Gly domain-containing linker protein 2; CLIP; CLIP 115; KIAA0291; WSCR3; WSCR4; |
Gene ID | 7461 |
mRNA Refseq | NM_032421 |
Protein Refseq | NP_115797 |
MIM | 603432 |
Uniprot ID | Q9UDT6 |
Chromosome Location | 7q11.23 |
Function | microtubule plus-end binding; |
◆ Recombinant Proteins | ||
CLIP2-1453R | Recombinant Rat CLIP2 Protein | +Inquiry |
CLIP2-3255H | Recombinant Human CLIP2 Protein, MYC/DDK-tagged | +Inquiry |
CLIP2-2201HF | Recombinant Full Length Human CLIP2 Protein, GST-tagged | +Inquiry |
CLIP2-27020TH | Recombinant Human CLIP2, His-tagged | +Inquiry |
CLIP2-1486H | Recombinant Human CLIP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIP2-365HCL | Recombinant Human CLIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLIP2 Products
Required fields are marked with *
My Review for All CLIP2 Products
Required fields are marked with *
0
Inquiry Basket