Recombinant Human CLEC3B Protein, His-tagged

Description :	Enables calcium ion binding activity; heparin binding activity; and kringle domain binding activity. Involved in bone mineralization and cellular response to transforming growth factor beta stimulus. Located in cytoplasm; extracellular space; and granular component. Part of collagen-containing extracellular matrix. Implicated in osteoarthritis.
Source :	HEK293
Species :	Human
Tag :	His
Form :	Lyophilized
Molecular Mass :	21 kDa
Protein length :	202
AA Sequence :	MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	CLEC3B C-type lectin domain family 3, member B [ Homo sapiens (human) ]
Official Symbol	CLEC3B
Synonyms	CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246;
Gene ID	7123
mRNA Refseq	NM_003278
Protein Refseq	NP_003269
MIM	187520
UniProt ID	P05452