Recombinant Human CLEC3B Protein, GST-tagged

Description :	CLEC3B (C-Type Lectin Domain Family 3 Member B) is a Protein Coding gene. Among its related pathways are Response to elevated platelet cytosolic Ca2+. GO annotations related to this gene include calcium ion binding and heparin binding. An important paralog of this gene is CLEC3A.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	47.96 kDa
AA Sequence :	MEVWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNGMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CLEC3B C-type lectin domain family 3, member B [ Homo sapiens ]
Official Symbol	CLEC3B
Synonyms	CLEC3B; C-type lectin domain family 3, member B; tetranectin (plasminogen binding protein) , TNA; tetranectin; TN; plasminogen kringle 4-binding protein; tetranectin (plasminogen binding protein); tetranectin (plasminogen-binding protein); TNA; DKFZp686H17246;
Gene ID	7123
mRNA Refseq	NM_003278
Protein Refseq	NP_003269
MIM	187520
UniProt ID	P05452