Recombinant Human CLEC1A Protein, GST-tagged

• Cat.No.: CLEC1A-1458H
• Product Overview: Human CLEC1A full-length ORF ( AAH39072, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded protein may play a role in regulating dendritic cell function. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.54 kDa
• AA Sequence: MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPRTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLEC1A C-type lectin domain family 1, member A [ Homo sapiens ]
• Official Symbol: CLEC1A
• Synonyms: CLEC1A; C-type lectin domain family 1, member A; C-type lectin domain family 1 member A; CLEC1; MGC34328; CLEC-1; C-type lectin-like receptor-1
• Gene ID: 51267
• mRNA Refseq: NM_016511
• Protein Refseq: NP_057595
• MIM: 606782
• UniProt ID: Q8NC01