Recombinant Human CLEC10A Protein, Fc-tagged
Cat.No. : | CLEC10A-182H |
Product Overview : | Recombinant human CLEC10A protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 316 |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may function as a cell surface antigen. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Form : | Lyophilized |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CLEC10A C-type lectin domain family 10, member A [ Homo sapiens (human) ] |
Official Symbol | CLEC10A |
Synonyms | CLEC10A; C-type lectin domain family 10, member A; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 14 (macrophage derived) , CLECSF13, CLECSF14; C-type lectin domain family 10 member A; CD301; HML; HML2; macrophage lectin 2 (calcium dependent); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived); C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived); MGL; CLECSF13; CLECSF14; |
Gene ID | 10462 |
mRNA Refseq | NM_006344 |
Protein Refseq | NP_006335 |
MIM | 605999 |
UniProt ID | Q8IUN9 |
◆ Recombinant Proteins | ||
Clec10a-1857M | Recombinant Mouse Clec10a protein, His & T7-tagged | +Inquiry |
Clec10a-1737M | Recombinant Mouse Clec10a Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC10A-3904H | Recombinant Human CLEC10A Protein (Gln61-Asn292), N-Fc tagged | +Inquiry |
CLEC10A-1450H | Recombinant Human CLEC10A Protein | +Inquiry |
CLEC10A-009H | Recombinant Human CLEC10A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC10A Products
Required fields are marked with *
My Review for All CLEC10A Products
Required fields are marked with *
0
Inquiry Basket