Recombinant Human CLDND1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CLDND1-4162H
• Product Overview: CLDND1 MS Standard C13 and N15-labeled recombinant protein (NP_063948) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CLDND1 (Claudin Domain Containing 1) is a Protein Coding gene. Diseases associated with CLDND1 include Renal Cell Carcinoma, Nonpapillary and Breast Cancer.
• Molecular Mass: 28.6 kDa
• AA Sequence: MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPVQENSSDLNKSIWDEFISDEADEKTYNDALFRYNGTVGLWRRCITIPKNMHWYSPPERTESFDVVTKCVSFTLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTIATGILHLLAGLCTLGSVSCYVAGIELLHQKLELPDNVSGEFGWSFCLACVSAPLQFMASALFIWAAHTNRKEYTLMKAYRVATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CLDND1 claudin domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: CLDND1
• Synonyms: CLDND1; claudin domain containing 1; C3orf4, chromosome 3 open reading frame 4; claudin domain-containing protein 1; membrane protein GENX-3745; claudin domain containing 1 protein; C3orf4; GENX-3745; MGC3316; MGC9861; MGC111162
• Gene ID: 56650
• mRNA Refseq: NM_019895
• Protein Refseq: NP_063948
• UniProt ID: Q9NY35