Recombinant Human CLDN8 Protein, GST-tagged

• Cat.No.: CLDN8-1448H
• Product Overview: Human CLDN8 full-length ORF ( NP_955360.1, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This protein plays important roles in the paracellular cation barrier of the distal renal tubule, and in the paracellular barrier to prevent sodium back-leakage in distal colon. Differential expression of this gene has been observed in colorectal carcinoma and renal cell tumors, and along with claudin-7, is an immunohistochemical marker for the differential diagnosis of chromophobe renal cell carcinoma and renal oncocytoma.[provided by RefSeq, May 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 51.2 kDa
• AA Sequence: MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNSIVNVAQKRELGEALYLGWTTALVLIVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLDN8 claudin 8 [ Homo sapiens ]
• Official Symbol: CLDN8
• Synonyms: CLDN8; claudin 8; claudin-8
• Gene ID: 9073
• mRNA Refseq: NM_199328
• Protein Refseq: NP_955360
• MIM: 611231
• UniProt ID: P56748