Recombinant Human CLDN6 Transmembrane protein (1-82 aa), His-SUMO-tagged

• Cat.No.: CLDN6-2711H
• Product Overview: Recombinant Human CLDN6 Protein (1-82 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-82aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.8kDa
• AA Sequence: MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CLDN6 claudin 6 [ Homo sapiens ]
• Official Symbol: CLDN6
• Synonyms: CLDN6; claudin 6; claudin-6; skullin
• Gene ID: 9074
• mRNA Refseq: NM_021195
• Protein Refseq: NP_067018
• UniProt ID: P56747