Recombinant Human CLDN2 protein(184-230 aa), GST-tagged
Cat.No. : | CLDN2-11292H |
Product Overview : | Recombinant Human CLDN2 protein(184-230 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Case Study
- Application
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 184-230 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
Gene Name | CLDN2 claudin 2 [ Homo sapiens ] |
Official Symbol | CLDN2 |
Synonyms | CLDN2; claudin 2; claudin-2; SP82 |
Gene ID | 9075 |
mRNA Refseq | NM_001171092 |
Protein Refseq | NP_001164563 |
MIM | 300520 |
UniProt ID | P57739 |
◆ Recombinant Proteins | ||
CLDN2-06HFL | Recombinant Full Length Human claudin 2 Protein, Flag tagged | +Inquiry |
CLDN2-11292H | Recombinant Human CLDN2 protein(184-230 aa), GST-tagged | +Inquiry |
RFL8713HF | Recombinant Full Length Human Claudin-2(Cldn2) Protein, His-Tagged | +Inquiry |
RFL21893BF | Recombinant Full Length Bovine Claudin-2(Cldn2) Protein, His-Tagged | +Inquiry |
RFL29997MF | Recombinant Full Length Mouse Claudin-2(Cldn2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Case 1: Tabariès S, et al. Commun Biol. 2021
Claudin-2 aids in liver metastasis of breast and colorectal cancers by supporting early cancer cell survival. It's linked to worse survival outcomes in colorectal cancer. Studies show higher Claudin-2 in replacement-type liver metastases, while Claudin-8 is up in desmoplastic types. Patient-derived xenografts show the same pattern. Claudin-2 in extracellular vesicles could identify liver metastasis types in colorectal cancer, guiding personalized treatment plans.

Fig1. Detailed assessment of the Claudin-2/Tubulin ratio in the mixed lesions.

Fig2. Immunoblot analysis of Claudin-2 and TSG101 using lysates prepared from EVs concentrated from patients.
Case 2: Hichino A, et al. J Biol Chem. 2017
Claudin-2 levels are high in lung adenocarcinoma, promoting cell growth. While specific drugs aren't available, azacitidine (AZA) and HDAC inhibitors like TSA and NaB show promise in lowering claudin-2. AZA works by blocking PI3K/Akt/NF-κB, while HDAC inhibitors boost miR-497 to destabilize claudin-2 mRNA. These treatments together reduce cancer cell growth, hinting that epigenetic inhibitors could be effective in controlling claudin-2-rich lung adenocarcinoma.

Fig1. Expression levels of claudin-1, claudin-2, occludin, and E-cadherin are represented as percentage of the values in 0 μm.

Fig2. Mock and claudin-2 expression vectors were transfected into A549 cells.

Fig1. Claudin-2 structure and interactions with cytosolic multidomain adapters. (Shruthi Venugopal, 2019)
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *
Inquiry Basket