Recombinant Human CLCN7 Protein, GST-tagged

• Cat.No.: CLCN7-1422H
• Product Overview: Human CLCN7 partial ORF ( NP_001278, 706 a.a. - 805 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CLCN7 chloride channel, voltage-sensitive 7 [ Homo sapiens ]
• Official Symbol: CLCN7
• Synonyms: CLCN7; chloride channel, voltage-sensitive 7; chloride channel 7; H(+)/Cl(-) exchange transporter 7; CLC 7; ClC 7; CLC7; OPTA2; PPP1R63; protein phosphatase 1; regulatory subunit 63; chloride channel protein 7; protein phosphatase 1, regulatory subunit 63; CLC-7; OPTB4; FLJ26686; FLJ39644; FLJ46423
• Gene ID: 1186
• mRNA Refseq: NM_001114331
• Protein Refseq: NP_001107803
• MIM: 602727
• UniProt ID: P51798