Recombinant Human CKS2 Protein, GST-tagged

• Cat.No.: CKS2-1404H
• Product Overview: Human CKS2 full-length ORF ( AAH06458, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008]
• Molecular Mass: 34.43 kDa
• AA Sequence: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CKS2 CDC28 protein kinase regulatory subunit 2 [ Homo sapiens ]
• Official Symbol: CKS2
• Synonyms: CKS2; CDC28 protein kinase regulatory subunit 2; CDC28 protein kinase 2; cyclin-dependent kinases regulatory subunit 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2; CKSHS2
• Gene ID: 1164
• mRNA Refseq: NM_001827
• Protein Refseq: NP_001818
• MIM: 116901
• UniProt ID: P33552