Recombinant Human CKMT2
Cat.No. : | CKMT2-26702TH |
Product Overview : | Recombinant full length Human CKMT2 with N terminal proprietary tag, 71.83kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 419 amino acids |
Description : | Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene. |
Molecular Weight : | 71.830kDa inclusive of tags |
Tissue specificity : | Sarcomere-specific. Found only in heart and skeletal muscles. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASIFSKLLTGRNASLLFATMGTSVLTTGYLLNRQKVCAE VREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKV TPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA DLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYV LSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLK GDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNM KRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSN LGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKK LERGQDIKVPPPLPQFGKK |
Sequence Similarities : | Belongs to the ATP:guanido phosphotransferase family.Contains 1 phosphagen kinase C-terminal domain.Contains 1 phosphagen kinase N-terminal domain. |
Gene Name | CKMT2 creatine kinase, mitochondrial 2 (sarcomeric) [ Homo sapiens ] |
Official Symbol | CKMT2 |
Synonyms | CKMT2; creatine kinase, mitochondrial 2 (sarcomeric); creatine kinase S-type, mitochondrial; SMTCK; |
Gene ID | 1160 |
mRNA Refseq | NM_001099735 |
Protein Refseq | NP_001093205 |
MIM | 123295 |
Uniprot ID | P17540 |
Chromosome Location | 5 |
Pathway | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem; |
Function | ATP binding; creatine kinase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
CKMT2-2979H | Recombinant Human CKMT2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ckmt2-2173M | Recombinant Mouse Ckmt2 Protein, Myc/DDK-tagged | +Inquiry |
CKMT2-1867HF | Recombinant Full Length Human CKMT2 Protein, GST-tagged | +Inquiry |
Ckmt2-1126R | Active Recombinant Rat Ckmt2 Protein, His-tagged | +Inquiry |
CKMT2-1401H | Recombinant Human CKMT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKMT2-7481HCL | Recombinant Human CKMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CKMT2 Products
Required fields are marked with *
My Review for All CKMT2 Products
Required fields are marked with *
0
Inquiry Basket