Recombinant Human CHST4 protein, His-tagged
Cat.No. : | CHST4-3227H |
Product Overview : | Recombinant Human CHST4 protein(177-386 aa), fused to His tag, was expressed in E. coli. |
Availability | March 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 177-386 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DPSLNLHIVHLVRDPRAVFRSRERTKGDLMIDSRIVMGQHEQKLKKEDQPYYVMQVICQSQLEIYKTIQSLPKALQERYLLVRYEDLARAPVAQTSRMYEFVGLEFLPHLQTWVHNITRGKGMGDHAFHTNARDALNVSQAWRWSLPYEKVSRLQKACGDAMNLLGYRHVRSEQEQRNLLLDLLSTWTVPEQIH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHST4 carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4 [ Homo sapiens ] |
Official Symbol | CHST4 |
Synonyms | CHST4; carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4; carbohydrate sulfotransferase 4; HEC GLCNAC 6 ST; LSST; GST-3; gn6st-2; glcNAc6ST-2; HEC-GlcNAc6ST; L-selectin ligand sulfotransferase; N-acetylglucosamine 6-O-sulfotransferase 2; high endothelial cells N-acetylglucosamine 6-O-sulfotransferase; galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3; galactose/N-acetylglucosamine/N-acetylgalactosamine 6-O-sulfotransferase 3; GST3; GlcNAc6ST2; HECGLCNAC6ST; |
Gene ID | 10164 |
mRNA Refseq | NM_001166395 |
Protein Refseq | NP_001159867 |
UniProt ID | Q8NCG5 |
◆ Recombinant Proteins | ||
CHST4-1835HF | Recombinant Full Length Human CHST4 Protein, GST-tagged | +Inquiry |
CHST4-1344H | Recombinant Human CHST4 Protein, GST-tagged | +Inquiry |
CHST4-561H | Active Recombinant Human CHST4 Protein, His-tagged | +Inquiry |
CHST4-1676M | Recombinant Mouse CHST4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHST4-11230H | Recombinant Human CHST4, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST4 Products
Required fields are marked with *
My Review for All CHST4 Products
Required fields are marked with *
0
Inquiry Basket