Recombinant Human CHRNB2 protein, His-V5-tagged

• Cat.No.: CHRNB2-0003H
• Product Overview: Recombinant Human CHRNB2 protein(26-233aa)(P17787), fused to N-terminal His tag and V5 tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&V5
• Protein Length: 26-233aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 31.9 kDa
• AA Sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CHRNB2 cholinergic receptor, nicotinic, beta 2 (neuronal) [ Homo sapiens ]
• Official Symbol: CHRNB2
• Synonyms: CHRNB2; cholinergic receptor, nicotinic, beta 2 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit beta-2; acetylcholine receptor; nicotinic; beta 2 (neuronal); neuronal nicotinic acetylcholine receptor beta 2; acetylcholine receptor, nicotinic, beta 2 (neuronal); EFNL3; nAChRB2
• Gene ID: 1141
• mRNA Refseq: NM_000748
• Protein Refseq: NP_000739
• MIM: 118507
• UniProt ID: P17787