Recombinant Human CHRM2 Protein, GST-Tagged

Cat.No. : CHRM2-1271H
Product Overview : Human CHRM2 partial ORF (AAI06743.1, 251 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.74 kDa
AA Sequence : SDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRM2 cholinergic receptor, muscarinic 2 [ Homo sapiens ]
Official Symbol CHRM2
Synonyms CHRM2; cholinergic receptor, muscarinic 2; muscarinic acetylcholine receptor M2; acetylcholine receptor; muscarinic 2; 7TM receptor; muscarinic M2 receptor; acetylcholine receptor, muscarinic 2; cholinergic receptor, muscarinic 2, isoform a; HM2; FLJ43243; MGC120006; MGC120007;
Gene ID 1129
mRNA Refseq NM_000739
Protein Refseq NP_000730
MIM 118493
UniProt ID P08172

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHRM2 Products

Required fields are marked with *

My Review for All CHRM2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon