Recombinant Human CHMP2B, His-tagged

• Cat.No.: CHMP2B-27997TH
• Product Overview: Recombinant full length Human CHMP2B with N terminal His tag; 223 amino acids with tag, Predicted MWt 26.1 kDa.

Specification

• Description: This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.
• Protein length: 213 amino acids
• Conjugation: HIS
• Molecular Weight: 26.100kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Widely expressed. Expressed in brain, heart, skeletal muscle, spleen, kidney, liver, small intestine, pancreas, lung, placenta and leukocytes. In brain, it is expressed in cerebellum, cerebral cortex, medulla, spinal chord, occipital lobe, frontal lobe, t
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
• Sequence Similarities: Belongs to the SNF7 family.

Gene Information

• Gene Name: CHMP2B charged multivesicular body protein 2B [ Homo sapiens ]
• Official Symbol: CHMP2B
• Synonyms: CHMP2B; charged multivesicular body protein 2B; chromatin modifying protein 2B; charged multivesicular body protein 2b; CHMP2.5; DKFZP564O123; VPS2 homolog B (S. cerevisiae); VPS2B
• Gene ID: 25978
• mRNA Refseq: NM_001244644
• Protein Refseq: NP_001231573
• Uniprot ID: Q9UQN3
• Chromosome Location: 3p12.1
• Pathway: ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem
• Function: protein domain specific binding