Recombinant Human CHMP2A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CHMP2A-4011H
• Product Overview: CHMP2A MS Standard C13 and N15-labeled recombinant protein (NP_940818) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A, is required for both MVB formation and regulation of cell cycle progression.
• Molecular Mass: 25.1 kDa
• AA Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CHMP2A charged multivesicular body protein 2A [ Homo sapiens (human) ]
• Official Symbol: CHMP2A
• Synonyms: CHMP2A; charged multivesicular body protein 2A; chromatin modifying protein 2A; charged multivesicular body protein 2a; BC 2; CHMP2; putative breast adenocarcinoma marker (32kD); VPS2; VPS2 homolog A (S. cerevisiae); VPS2A; vps2-1; hVps2-1; VPS2 homolog A; chromatin-modifying protein 2a; putative breast adenocarcinoma marker BC-2; vacuolar protein sorting-associated protein 2-1; BC2; BC-2
• Gene ID: 27243
• mRNA Refseq: NM_198426
• Protein Refseq: NP_940818
• MIM: 610893
• UniProt ID: O43633