Recombinant Human CHGA protein, GST-tagged

Cat.No. : CHGA-2692H
Product Overview : Recombinant Human CHGA protein(P10645)(224-457aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 224-457aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 53.4 kDa
AA Sequence : QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CHGA chromogranin A (parathyroid secretory protein 1) [ Homo sapiens ]
Official Symbol CHGA
Synonyms CHGA; chromogranin A (parathyroid secretory protein 1); chromogranin-A; pancreastatin; parastatin; vasostatin; SP-I; pituitary secretory protein I; parathyroid secretory protein 1; betagranin (N-terminal fragment of chromogranin A); CGA;
Gene ID 1113
mRNA Refseq NM_001275
Protein Refseq NP_001266
MIM 118910
UniProt ID P10645

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CHGA Products

Required fields are marked with *

My Review for All CHGA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon