Recombinant Human CHD4
Cat.No. : | CHD4-27065TH |
Product Overview : | Recombinant fragment of Human CHD4 protein with an N terminal proprietary tag; predicted MWt: 36.52 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 99 amino acids |
Description : | The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. |
Molecular Weight : | 36.520kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH |
Sequence Similarities : | Belongs to the SNF2/RAD54 helicase family.Contains 2 chromo domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 2 PHD-type zinc fingers. |
Gene Name | CHD4 chromodomain helicase DNA binding protein 4 [ Homo sapiens ] |
Official Symbol | CHD4 |
Synonyms | CHD4; chromodomain helicase DNA binding protein 4; chromodomain-helicase-DNA-binding protein 4; Mi 2b; Mi2 BETA; |
Gene ID | 1108 |
mRNA Refseq | NM_001273 |
Protein Refseq | NP_001264 |
MIM | 603277 |
Uniprot ID | Q14839 |
Chromosome Location | 12p13 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | ATP binding; ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
CHD4-2793H | Recombinant Human CHD4 protein, GST-tagged | +Inquiry |
CHD4-0338H | Recombinant Human CHD4 Protein (Met1-Gln1912), C-His-tagged | +Inquiry |
CHD4-772H | Recombinant Human CHD4 Protein, His-tagged | +Inquiry |
CHD4-1180H | Recombinant Human CHD4 Protein (1-239 aa), His-tagged | +Inquiry |
CHD4-0339H | Recombinant full length Human CHD4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHD4-346HCL | Recombinant Human CHD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHD4 Products
Required fields are marked with *
My Review for All CHD4 Products
Required fields are marked with *
0
Inquiry Basket