Recombinant Human CHCHD4 protein, GST-tagged

• Cat.No.: CHCHD4-30197H
• Product Overview: Recombinant Human CHCHD4 (1-142 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Ser142
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CHCHD4 coiled-coil-helix-coiled-coil-helix domain containing 4 [ Homo sapiens ]
• Official Symbol: CHCHD4
• Synonyms: CHCHD4; coiled-coil-helix-coiled-coil-helix domain containing 4; mitochondrial intermembrane space import and assembly protein 40; FLJ31709; MIA40; mitochondrial intermembrane space import and assembly 40 homolog (S. cerevisiae); TIMM40; translocase of inner mitochondrial membrane 40 homolog (S. cerevisiae); translocase of inner mitochondrial membrane 40 homolog; coiled-coil-helix-coiled-coil-helix domain-containing protein 4; mitochondrial intermembrane space import and assembly 40 homolog
• Gene ID: 131474
• mRNA Refseq: NM_001098502
• Protein Refseq: NP_001091972
• MIM: 611077
• UniProt ID: Q8N4Q1