Recombinant Human CGB5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CGB5-712H
• Product Overview: CGB5 MS Standard C13 and N15-labeled recombinant protein (NP_149032) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 5 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene.
• Molecular Mass: 17.7 kDa
• AA Sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CGB5 chorionic gonadotropin subunit beta 5 [ Homo sapiens (human) ]
• Official Symbol: CGB5
• Synonyms: CGB5; chorionic gonadotropin, beta polypeptide 5; HCG; chorionic gonadotropin beta 5 subunit; MGC119822
• Gene ID: 93659
• mRNA Refseq: NM_033043
• Protein Refseq: NP_149032
• MIM: 608825
• UniProt ID: P01233