Recombinant Human CGA, StrepII-tagged
Cat.No. : | CGA-224H |
Product Overview : | Purified, full-length human recombinant Human chorionic gonadotropin or hCG protein (amino acids 21-165, 145 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 15.5 kDa. (Accession NP_000728; UniProt P01233) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 21-165, 145 a.a. |
Description : | HCG is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and a unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRG VNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | CGA glycoprotein hormones, alpha polypeptide [ Homo sapiens ] |
Official Symbol | CGA |
Synonyms | CGA; glycoprotein hormones, alpha polypeptide; glycoprotein hormones alpha chain; chorionic gonadotropin; alpha polypeptide; follicle stimulating hormone alpha subunit; FSHA; GPHa; GPHA1; HCG; LHA; luteinizing hormone alpha chain; lutropin alpha chain; thyroid stimulating hormone alpha chain; TSHA; FSH-alpha; LSH-alpha; TSH-alpha; follitropin alpha chain; thyrotropin alpha chain; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; thyroid-stimulating hormone alpha chain; follicle-stimulating hormone alpha chain; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha subunit; anterior pituitary glycoprotein hormones common subunit alpha; CG-ALPHA; |
Gene ID | 1081 |
mRNA Refseq | NM_000735 |
Protein Refseq | NP_000726 |
MIM | 118850 |
UniProt ID | P01215 |
Chromosome Location | 6q14-q21 |
Pathway | Amine-derived hormones, organism-specific biosystem; Androgen biosynthesis, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function | hormone activity; protein binding; |
◆ Recombinant Proteins | ||
CGA-109H | Recombinant Human Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
CGA-452H | Recombinant Human CGA Protein (Met1-Ser116) | +Inquiry |
CGA-285H | Recombinant Human CGA, Fc-tagged | +Inquiry |
CGA-1182H | Recombinant Human CGA Protein, GST-Tagged | +Inquiry |
CGA-7786H | Recombinant Human CGA protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8163H | Native Human Chorionic Gonadotropin | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
CGA-8356H | Native Human CGA | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGA-001HCL | Recombinant Human CGA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CGA Products
Required fields are marked with *
My Review for All CGA Products
Required fields are marked with *
0
Inquiry Basket