Recombinant Human CGA, StrepII-tagged

Cat.No. : CGA-224H
Product Overview : Purified, full-length human recombinant Human chorionic gonadotropin or hCG protein (amino acids 21-165, 145 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 15.5 kDa. (Accession NP_000728; UniProt P01233)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 21-165, 145 a.a.
Description : HCG is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and a unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRG VNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name CGA glycoprotein hormones, alpha polypeptide [ Homo sapiens ]
Official Symbol CGA
Synonyms CGA; glycoprotein hormones, alpha polypeptide; glycoprotein hormones alpha chain; chorionic gonadotropin; alpha polypeptide; follicle stimulating hormone alpha subunit; FSHA; GPHa; GPHA1; HCG; LHA; luteinizing hormone alpha chain; lutropin alpha chain; thyroid stimulating hormone alpha chain; TSHA; FSH-alpha; LSH-alpha; TSH-alpha; follitropin alpha chain; thyrotropin alpha chain; choriogonadotropin alpha chain; chorionic gonadotrophin subunit alpha; thyroid-stimulating hormone alpha chain; follicle-stimulating hormone alpha chain; chorionic gonadotropin, alpha polypeptide; follicle-stimulating hormone alpha subunit; anterior pituitary glycoprotein hormones common subunit alpha; CG-ALPHA;
Gene ID 1081
mRNA Refseq NM_000735
Protein Refseq NP_000726
MIM 118850
UniProt ID P01215
Chromosome Location 6q14-q21
Pathway Amine-derived hormones, organism-specific biosystem; Androgen biosynthesis, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function hormone activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CGA Products

Required fields are marked with *

My Review for All CGA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon