Recombinant Human CFHR2 protein, GST-tagged

• Cat.No.: CFHR2-27137TH
• Product Overview: Recombinant Human CFHR2(19 a.a. - 270 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene belongs to a family of complement factor H-related genes (CFHR), which are clustered together with complement factor H gene on chromosome 1, and are involved in regulation of complement. Mutations in CFHR genes have been associated with dense deposit disease and atypical haemolytic-uraemic syndrome. Alternatively spliced transcript variants have been found for this gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 53.46 kDa
• AA Sequence: EAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVE NGHSESSGQTHLEGDTVQIICNTGYRLQNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVY APGSSVEYQCQNLYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFVCKS GYHPTKSHSFRAMCQNGKLVYPSCEEK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 19-270 a.a.

Gene Information

• Gene Name: CFHR2 complement factor H-related 2 [ Homo sapiens ]
• Official Symbol: CFHR2
• Synonyms: CFHR2; complement factor H-related 2; CFHL2, H factor (complement) like 3 , HFL3; complement factor H-related protein 2; FHR2; FHR-2; DDESK59; h factor-like 3; factor H-related gene 2; h factor-like protein 2; H factor (complement)-like 3; HFL3; CFHL2
• Gene ID: 3080
• mRNA Refseq: NM_005666
• Protein Refseq: NP_005657
• MIM: 600889
• UniProt ID: P36980
• Chromosome Location: 1q31.3