Recombinant Human CFHR1 protein(132-221aa), His-GST&Myc-tagged
Cat.No. : | CFHR1-2819H |
Product Overview : | Recombinant Human CFHR1 protein(Q03591)(132-221aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 132-221aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITS |
Gene Name | CFHR1 complement factor H-related 1 [ Homo sapiens ] |
Official Symbol | CFHR1 |
Synonyms | CFHR1; complement factor H-related 1; CFHL1, CFHL1P, CFHR1P, complement factor H related 1 pseudogene , H factor (complement) like 1 , H factor (complement) like 2 , HFL1, HFL2; complement factor H-related protein 1; CFHL; FHR1; H36 1; H36 2; H36; FHR-1; H-factor-like 1; h factor-like protein 1; H factor (complement)-like 1; H factor (complement)-like 2; complement factor H-related 1 pseudogene; HFL1; HFL2; CFHL1; H36-1; H36-2; CFHL1P; CFHR1P; MGC104329; |
Gene ID | 3078 |
mRNA Refseq | NM_002113 |
Protein Refseq | NP_002104 |
MIM | 134371 |
UniProt ID | Q03591 |
◆ Recombinant Proteins | ||
CFHL1-3595Z | Recombinant Zebrafish CFHL1 | +Inquiry |
CFHR1-2819H | Recombinant Human CFHR1 protein(132-221aa), His-GST&Myc-tagged | +Inquiry |
CFHR1-764H | Recombinant Human CFHR1 Protein, His-tagged | +Inquiry |
CFHR1-269H | Recombinant Human CFHR1, His-tagged | +Inquiry |
CFHR1-27138TH | Recombinant Human CFHR1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFHR1-1289HCL | Recombinant Human CFHR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFHR1 Products
Required fields are marked with *
My Review for All CFHR1 Products
Required fields are marked with *
0
Inquiry Basket