Recombinant Human CFH protein, His-tagged

• Cat.No.: CFH-574H
• Product Overview: Recombinant Human CFH protein(P08603)(19-449aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-449a.a.
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS

Gene Information

• Gene Name: CFH complement factor H [ Homo sapiens ]
• Official Symbol: CFH
• Synonyms: CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS; beta-1H; factor H; factor H-like 1; beta-1-H-globulin; H factor 1 (complement); adrenomedullin binding protein; complement factor H, isoform b; age-related maculopathy susceptibility 1; FH; HF; HF1; HF2; AHUS1; AMBP1; ARMD4; CFHL3; MGC88246
• Gene ID: 3075
• mRNA Refseq: NM_000186
• Protein Refseq: NP_000177
• MIM: 134370
• UniProt ID: P08603