Recombinant Human CFH protein, His-tagged

Source :	E.coli
Species :	Human
Tag :	His
Protein length :	19-449a.a.
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	50.5 kDa
AASequence :	EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS
Purity :	Greater than 85% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Name	CFH complement factor H [ Homo sapiens ]
Official Symbol	CFH
Synonyms	CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS; beta-1H; factor H; factor H-like 1; beta-1-H-globulin; H factor 1 (complement); adrenomedullin binding protein; complement factor H, isoform b; age-related maculopathy susceptibility 1; FH; HF; HF1; HF2; AHUS1; AMBP1; ARMD4; CFHL3; MGC88246;
Gene ID	3075
mRNA Refseq	NM_000186
Protein Refseq	NP_000177
MIM	134370
UniProt ID	P08603