Recombinant Human CFH protein, His-tagged
Cat.No. : | CFH-574H |
Product Overview : | Recombinant Human CFH protein(P08603)(19-449aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-449a.a. |
Tag : | His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS |
Gene Name | CFH complement factor H [ Homo sapiens ] |
Official Symbol | CFH |
Synonyms | CFH; complement factor H; H factor 1 (complement) , HF, HF1, HF2; age related maculopathy susceptibility 1; ARMS1; beta 1H; FHL1; H factor 2 (complement); HUS; beta-1H; factor H; factor H-like 1; beta-1-H-globulin; H factor 1 (complement); adrenomedullin binding protein; complement factor H, isoform b; age-related maculopathy susceptibility 1; FH; HF; HF1; HF2; AHUS1; AMBP1; ARMD4; CFHL3; MGC88246; |
Gene ID | 3075 |
mRNA Refseq | NM_000186 |
Protein Refseq | NP_000177 |
MIM | 134370 |
UniProt ID | P08603 |
◆ Recombinant Proteins | ||
CFH-26763TH | Recombinant Human CFH, His-tagged | +Inquiry |
Cfh-643R | Recombinant Rat Cfh protein, His-tagged | +Inquiry |
CFH-762H | Recombinant Human CFH Protein, His-tagged | +Inquiry |
Cfh-761M | Recombinant Mouse Cfh protein, His-GST-tagged | +Inquiry |
Cfh-626M | Active Recombinant Mouse Cfh Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFH-115H | Active Native Human Factor H | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFH-2409HCL | Recombinant Human CFH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFH Products
Required fields are marked with *
My Review for All CFH Products
Required fields are marked with *
0
Inquiry Basket