Recombinant Human CFDP1 protein, His-tagged
Cat.No. : | CFDP1-3789H |
Product Overview : | Recombinant Human CFDP1 protein(172-299 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 172-299 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CFDP1 craniofacial development protein 1 [ Homo sapiens ] |
Official Symbol | CFDP1 |
Synonyms | CFDP1; craniofacial development protein 1; BCNT; Bucentaur; CENP 29; centromere protein 29; CP27; p97; SWC5; Yeti; phosphoprotein (Bucentaur); CENP-29; BUCENTAUR; |
Gene ID | 10428 |
mRNA Refseq | NM_006324 |
Protein Refseq | NP_006315 |
MIM | 608108 |
UniProt ID | Q9UEE9 |
◆ Recombinant Proteins | ||
CFDP1-653R | Recombinant Rhesus Macaque CFDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFDP1-301301H | Recombinant Human CFDP1 protein, GST-tagged | +Inquiry |
CFDP1-1166H | Recombinant Human CFDP1 Protein, GST-Tagged | +Inquiry |
CFDP1-2128H | Recombinant Human CFDP1 Protein (1-299 aa), GST-tagged | +Inquiry |
CFDP1-827R | Recombinant Rhesus monkey CFDP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CFDP1-7557HCL | Recombinant Human CFDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CFDP1 Products
Required fields are marked with *
My Review for All CFDP1 Products
Required fields are marked with *
0
Inquiry Basket