Recombinant Human CFAP20 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CFAP20-1084H
• Product Overview: C16orf80 MS Standard C13 and N15-labeled recombinant protein (NP_037374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CFAP20 (Cilia And Flagella Associated Protein 20) is a Protein Coding gene. Diseases associated with CFAP20 include Familial Atrial Fibrillation. An important paralog of this gene is CFAP20DC.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.8 kDa
• AA Sequence: MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CFAP20 cilia and flagella associated protein 20 [ Homo sapiens (human) ]
• Official Symbol: CFAP20
• Synonyms: CFAP20; cilia and flagella associated protein 20; GTL3; BUG22; EVORF; fSAP23; C16orf80; cilia- and flagella-associated protein 20; UPF0468 protein C16orf80; basal body up-regulated protein 22; flagellar associated protein 20 homolog; functional spliceosome-associated protein 23; gene trap locus 3; transcription factor IIB
• Gene ID: 29105
• mRNA Refseq: NM_013242
• Protein Refseq: NP_037374
• MIM: 617906
• UniProt ID: Q9Y6A4