Recombinant Human CETN3 Protein, GST-Tagged
Cat.No. : | CETN3-1158H |
Product Overview : | Human CETN3 full-length ORF (NP_004356.2, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the centrosome of interphase and mitotic cells, where it plays a fundamental role in centrosome duplication and separation. Multiple forms of the proteins similar to the yeast centrin have been identified in human and other mammalian cells, some of which have been shown to be associated with centrosome fractions. This protein appears to be one of the most abundant centrins associated with centrosome, which suggests a similar function to its yeast counterpart. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 45.9 kDa |
AA Sequence : | MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISLRNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CETN3 centrin, EF-hand protein, 3 [ Homo sapiens ] |
Official Symbol | CETN3 |
Synonyms | CETN3; centrin, EF-hand protein, 3; centrin, EF hand protein, 3 (CDC31 yeast homolog); centrin-3; CDC31 yeast homolog; CEN3; EF hand superfamily member; EF-hand superfamily member; centrin, EF-hand protein, 3 (CDC31 homolog, yeast); MGC12502; MGC138245; |
Gene ID | 1070 |
mRNA Refseq | NM_004365 |
Protein Refseq | NP_004356 |
MIM | 602907 |
UniProt ID | O15182 |
◆ Recombinant Proteins | ||
Cetn3-879M | Recombinant Mouse Cetn3 Protein, MYC/DDK-tagged | +Inquiry |
CETN3-2697Z | Recombinant Zebrafish CETN3 | +Inquiry |
CETN3-2788H | Recombinant Human Centrin, EF-hand Protein, 3, His-tagged | +Inquiry |
CETN3-651R | Recombinant Rhesus Macaque CETN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CETN3-2689H | Recombinant Human CETN3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN3-7560HCL | Recombinant Human CETN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CETN3 Products
Required fields are marked with *
My Review for All CETN3 Products
Required fields are marked with *
0
Inquiry Basket