Recombinant Human CELSR2 protein, GST-tagged

• Cat.No.: CELSR2-18H
• Product Overview: Recombinant Human CELSR2(124 a.a. - 233 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 124-233 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CELSR2 cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila) [ Homo sapiens ]
• Official Symbol: CELSR2
• Synonyms: CELSR2; cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila); cadherin, EGF LAG seven pass G type receptor 2, flamingo (Drosophila) homolog , EGFL2; cadherin EGF LAG seven-pass G-type receptor 2; CDHF10; Flamingo1; KIAA0279; MEGF3; EGF-like protein 2; flamingo homolog 3; cadherin family member 10; EGF-like-domain, multiple 2; epidermal growth factor-like 2; multiple EGF-like domains protein 3; epidermal growth factor-like protein 2; multiple epidermal growth factor-like domains 3; multiple epidermal growth factor-like domains protein 3; EGFL2; FLJ34118; FLJ42737; FLJ45143; FLJ45845
• Gene ID: 1952
• mRNA Refseq: NM_001408
• Protein Refseq: NP_001399
• MIM: 604265
• UniProt ID: Q9HCU4
• Chromosome Location: 1p13.3
• Pathway: GPCRs, Other, organism-specific biosystem
• Function: G-protein coupled receptor activity; binding; calcium ion binding; receptor activity; signal transducer activity