Recombinant Human CELSR2 protein, GST-tagged
Cat.No. : | CELSR2-18H |
Product Overview : | Recombinant Human CELSR2(124 a.a. - 233 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 124-233 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CELSR2 cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila) [ Homo sapiens ] |
Official Symbol | CELSR2 |
Synonyms | CELSR2; cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila); cadherin, EGF LAG seven pass G type receptor 2, flamingo (Drosophila) homolog , EGFL2; cadherin EGF LAG seven-pass G-type receptor 2; CDHF10; Flamingo1; KIAA0279; MEGF3; EGF-like protein 2; flamingo homolog 3; cadherin family member 10; EGF-like-domain, multiple 2; epidermal growth factor-like 2; multiple EGF-like domains protein 3; epidermal growth factor-like protein 2; multiple epidermal growth factor-like domains 3; multiple epidermal growth factor-like domains protein 3; EGFL2; FLJ34118; FLJ42737; FLJ45143; FLJ45845; |
Gene ID | 1952 |
mRNA Refseq | NM_001408 |
Protein Refseq | NP_001399 |
MIM | 604265 |
UniProt ID | Q9HCU4 |
Chromosome Location | 1p13.3 |
Pathway | GPCRs, Other, organism-specific biosystem; |
Function | G-protein coupled receptor activity; binding; calcium ion binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
Celsr2-356M | Recombinant Mouse Celsr2 protein, His-tagged | +Inquiry |
CELSR2-472H | Recombinant Human CELSR2 Protein, His-tagged | +Inquiry |
CELSR2-2653H | Recombinant Human CELSR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CELSR2-357H | Recombinant Human CELSR2 protein, His-tagged | +Inquiry |
Celsr2-358R | Recombinant Rat Celsr2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CELSR2 Products
Required fields are marked with *
My Review for All CELSR2 Products
Required fields are marked with *
0
Inquiry Basket