Recombinant Human CELA3B protein, His-tagged

• Cat.No.: CELA3B-1165H
• Product Overview: Recombinant Human CELA3B protein(P08861)(29-270aa), fused to N-terminal His tag, was expressed in Baculovirus-Insect cell.

Specification

• Source: Insect cell
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.8kDa
• Protein length: 29-270aa
• AA Sequence: VVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: CELA3B chymotrypsin like elastase family member 3B [ Homo sapiens (human) ]
• Official Symbol: CELA3B
• Synonyms: CELA3B; chymotrypsin like elastase family member 3B; CBPP; ELA3B; chymotrypsin-like elastase family member 3B; cholesterol-binding pancreatic protease; elastase 3B, pancreatic; elastase IIIB; elastase-3B; fecal elastase 1; pancreatic elastase 1; pancreatic endopeptidase E; protease E; proteinase E
• Gene ID: 23436
• mRNA Refseq: NM_007352
• Protein Refseq: NP_031378
• UniProt ID: P08861