Recombinant Human CEBPD Protein, GST-Tagged

• Cat.No.: CEBPD-1103H
• Product Overview: Human CEBPD full-length ORF (NP_005186.2, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulation of genes involved in immune and inflammatory responses, and may be involved in the regulation of genes associated with activation and/or differentiation of macrophages. The cytogenetic location of this locus has been reported as both 8p11 and 8q11. [provided by RefSeq, Sep 2010]
• Molecular Mass: 55.99 kDa
• AA Sequence: MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEBPD CCAAT/enhancer binding protein (C/EBP), delta [ Homo sapiens ]
• Official Symbol: CEBPD
• Synonyms: CEBPD; CCAAT/enhancer binding protein (C/EBP), delta; CCAAT/enhancer-binding protein delta; C/EBP delta; CELF; CRP3; NF IL6 beta; c/EBP delta; nuclear factor NF-IL6-beta; C/EBP-delta; NF-IL6-beta
• Gene ID: 1052
• mRNA Refseq: NM_005195
• Protein Refseq: NP_005186
• MIM: 116898
• UniProt ID: P49716