Recombinant Human CDO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CDO1-1371H
• Product Overview: CDO1 MS Standard C13 and N15-labeled recombinant protein (NP_001792) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Initiates several important metabolic pathways related to pyruvate and several sulfurate compounds including sulfate, hypotaurine and taurine. Critical regulator of cellular cysteine concentrations. Has an important role in maintaining the hepatic concentation of intracellular free cysteine within a proper narrow range.
• Molecular Mass: 23 kDa
• AA Sequence: MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CDO1 cysteine dioxygenase type 1 [ Homo sapiens (human) ]
• Official Symbol: CDO1
• Synonyms: CDO1; cysteine dioxygenase, type I; cysteine dioxygenase type 1; CDO; CDO-I
• Gene ID: 1036
• mRNA Refseq: NM_001801
• Protein Refseq: NP_001792
• MIM: 603943
• UniProt ID: Q16878