Recombinant Human CDKN2B Protein, GST-Tagged

Cat.No. : CDKN2B-1064H
Product Overview : Human CDKN2B full-length ORF (AAH14469, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Entrez Gene Summary for CDKN2B Gene
This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 40.92 kDa
AA Sequence : MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDKN2B cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) [ Homo sapiens ]
Official Symbol CDKN2B
Synonyms CDKN2B; cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4); cyclin-dependent kinase 4 inhibitor B; CDK4I; INK4B; MTS2; P15; p15INK4b; TP15; MTS-2; p14-INK4b; p14_INK4B; p15-INK4b; p15_INK4B; CDK4B inhibitor; p14_CDK inhibitor; p15 CDK inhibitor; CDK inhibitory protein; multiple tumor suppressor 2; cyclin-dependent kinases 4 and 6 binding protein;
Gene ID 1030
mRNA Refseq NM_004936
Protein Refseq NP_004927
MIM 600431
UniProt ID P42772

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDKN2B Products

Required fields are marked with *

My Review for All CDKN2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon