Tag :	N-GST
ProteinLength :	54-170 aa
Tag :	N-GST
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	VTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
Purity :	90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	CDKN1A cyclin-dependent kinase inhibitor 1A (p21, Cip1) [ Homo sapiens ]
Official Symbol	CDKN1A
Synonyms	CDKN1A; cyclin-dependent kinase inhibitor 1A (p21, Cip1); CDKN1; cyclin-dependent kinase inhibitor 1; CAP20; CIP1; P21; p21CIP1; p21Cip1/Waf1; SDI1; WAF1; DNA synthesis inhibitor; CDK-interacting protein 1; CDK-interaction protein 1; wild-type p53-activated fragment 1; melanoma differentiation associated protein 6; MDA-6;
Gene ID	1026
mRNA Refseq	NM_000389
Protein Refseq	NP_000380
MIM	116899
UniProt ID	P38936

COA

Cat.No. :	CDKN1A-4211H
Product Overview :	Recombinant Human CDKN1A protein(54-170 aa), fused with N-terminal GST tag, was expressed in E. coli.

Recombinant Human CDKN1A protein, GST-tagged