Recombinant Human CDK7 protein(1-346aa), His-tagged
Cat.No. : | CDK7-8372H |
Product Overview : | Recombinant Human CDK7 protein(P50613)(1-346aa), fused with N-terminal His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 1-346aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 41.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Gene Name | CDK7 cyclin-dependent kinase 7 [ Homo sapiens ] |
Official Symbol | CDK7 |
Synonyms | CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase) , cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15; |
Gene ID | 1022 |
mRNA Refseq | NM_001799 |
Protein Refseq | NP_001790 |
MIM | 601955 |
UniProt ID | P50613 |
◆ Recombinant Proteins | ||
CDK7-568H | Recombinant Human CDK7 | +Inquiry |
CDK7-0810H | Recombinant Human CDK7 Protein (Met1-Phe346), N-His tagged | +Inquiry |
Cdk7-1925M | Recombinant Mouse Cdk7 protein, His-tagged | +Inquiry |
CDK7-12210Z | Recombinant Zebrafish CDK7 | +Inquiry |
CDK7-1036H | Active Recombinant Human CDK7 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK7-7621HCL | Recombinant Human CDK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK7 Products
Required fields are marked with *
My Review for All CDK7 Products
Required fields are marked with *
0
Inquiry Basket