Recombinant Human CDK1 protein, T7/His-tagged

Cat.No. : CDK1-213H
Product Overview : Recombinant human CDK1 cDNA (297aa, Isoform-1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 297 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPST AIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSR RVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAEL ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDP AKRISGKMALNHPYFNDLDNQIKKM
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name CDK1 cyclin-dependent kinase 1 [ Homo sapiens ]
Official Symbol CDK1
Synonyms CDK1; cyclin-dependent kinase 1; CDC2, cell division cycle 2, G1 to S and G2 to M; CDC28A; p34 protein kinase; cell cycle controller CDC2; cell division protein kinase 1; cell division control protein 2 homolog; cell division cycle 2, G1 to S and G2 to M; CDC2; P34CDC2; MGC111195; DKFZp686L20222;
Gene ID 983
mRNA Refseq NM_001170406
Protein Refseq NP_001163877
MIM 116940
UniProt ID P06493
Chromosome Location 10q21.2
Pathway APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; ARMS-mediated activation, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem;
Function ATP binding; Hsp70 protein binding; RNA polymerase II carboxy-terminal domain kinase activity; cyclin binding; cyclin-dependent protein kinase activity; cyclin-dependent protein kinase activity; histone kinase activity; nucleotide binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDK1 Products

Required fields are marked with *

My Review for All CDK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon