Recombinant Human CDHR5 Protein, GST-tagged

• Cat.No.: CDHR5-5752H
• Product Overview: Human MUCDHL partial ORF ( NP_068743, 27 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a novel mucin-like gene that is a member of the cadherin superfamily. While encoding nonpolymorphic tandem repeats rich in proline, serine and threonine similar to mucin proteins, the gene also contains sequence encoding calcium-binding motifs found in all cadherins. The role of the hybrid extracellular region and the specific function of this protein have not yet been determined. Alternative splicing has been identified, with observed variation resulting in the presence or absence of domains. In addition, splicing occurs in the 5 UTR but transcripts including these variations have not been described completely. [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: AQYCSVNKDIFEVEENTNVTEPLVDIHVPEGQEVTLGALSTPFAFRIQGNQLFLNVTPDYEEKSLLEAQLLCQSGGTLVTQLRVFVSVLDVNDNAPEFP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDHR5 cadherin related family member 5 [ Homo sapiens (human) ]
• Official Symbol: CDHR5
• Synonyms: CDHR5; cadherin related family member 5; MLPCDH; MUCDHL; MUPCDH; MU-PCDH; cadherin-related family member 5; differentiation-associated catenin regulator; mu-protocadherin; mucin and cadherin-like protein
• Gene ID: 53841
• mRNA Refseq: NM_001171968
• Protein Refseq: NP_001165439
• MIM: 606839
• UniProt ID: Q9HBB8