Recombinant Human CDH4 Protein, GST-Tagged

Description :	This gene is a classical cadherin from the cadherin superfamily. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Based on studies in chicken and mouse, this cadherin is thought to play an important role during brain segmentation and neuronal outgrowth. In addition, a role in kidney and muscle development is indicated. Of particular interest are studies showing stable cis-heterodimers of cadherins 2 and 4 in cotransfected cell lines. Previously thought to interact in an exclusively homophilic manner, this is the first evidence of cadherin heterodimerization. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.74 kDa
AA Sequence :	AADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGA
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CDH4 cadherin 4, type 1, R-cadherin (retinal) [ Homo sapiens ]
Official Symbol	CDH4
Synonyms	CDH4; cadherin 4, type 1, R-cadherin (retinal); cadherin-4; R Cadherin; R-CAD; R-cadherin; retinal cadherin; cadherin 4, type 1, preproprotein; CAD4; RCAD; FLJ22202; FLJ40547; MGC126700; MGC138355;
Gene ID	1002
mRNA Refseq	NM_001252338
Protein Refseq	NP_001239267
MIM	603006
UniProt ID	P55283